PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05901.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 236aa    MW: 26016 Da    PI: 9.4841
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05901.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28e-181461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT+eEde+lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc05901.1.g00040.1.sm.mk 14 RGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                                  89******************************99************97 PP

2Myb_DNA-binding55.81.1e-1767111147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T++Ed+l+v+++ +lG++ W+ Ia++++ gRt++++k++w+++
  Zmw_sc05901.1.g00040.1.sm.mk  67 RGNFTPDEDDLIVKLHGLLGNK-WSVIAARLP-GRTDNEIKNYWNTH 111
                                   89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.979961IPR017930Myb domain
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
SuperFamilySSF466891.91E-2913108IPR009057Homeodomain-like
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001674.90E-111661No hitNo description
PROSITE profilePS5129426.90362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2765116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002493.5E-1667111IPR001005SANT/Myb domain
CDDcd001673.43E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRSPCCEKA HTNRGAWTKE EDERLVAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TPDEDDLIVK LHGLLGNKWS VIAARLPGRT DNEIKNYWNT HVRKKLLSVG  120
IDPVTHRPIR QVQASSQSTP AAALKTTPRC PDLNLDLCIR PPSPFQEREE PPVIVKRELL  180
HLQGGGHGRG GGLCLGCCSS LGLNKGAADC GCGGNNQHFL GLRLGVLDFR GGLEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974147.11e-113PREDICTED: myb-related protein Zm38-like
SwissprotP200251e-111MYB38_MAIZE; Myb-related protein Zm38
TrEMBLK3YLF71e-112K3YLF7_SETIT; Uncharacterized protein
STRINGSi015081m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448